PDB entry 1dee

View 1dee on RCSB PDB site
Description:
Deposited on 1999-11-15, released 2000-05-24
The last revision prior to the SCOP 1.67 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deea1, d1deea2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deeb1, d1deeb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deec1, d1deec2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deed1, d1deed2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deee1, d1deee2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deef1, d1deef2
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deeg_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1deeh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeA (A:)
    diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeB (B:)
    qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
    sgsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeC (C:)
    diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeD (D:)
    qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
    sgsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeE (E:)
    diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsysaprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeF (F:)
    qvqlvesgggvvqpgkslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
    sgsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1deeG (G:)
    fnkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1deeG (G:)
    dqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deeH (H:)
    fnkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk