PDB entry 1ded

View 1ded on RCSB PDB site
Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution
Class: transferase
Keywords: cyclodextrin glucanotransferase, cgtase, acarbose, transferase
Deposited on 1999-11-14, released 2000-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • engineered (232)
      • conflict (451)
      • conflict (453)
    Domains in SCOPe 2.07: d1deda1, d1deda2, d1deda3, d1deda4
  • Chain 'B':
    Compound: cyclodextrin glucanotransferase
    Species: Bacillus sp. [TaxId:1410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05618 (0-685)
      • engineered (232)
      • conflict (451)
      • conflict (453)
    Domains in SCOPe 2.07: d1dedb1, d1dedb2, d1dedb3, d1dedb4
  • Heterogens: CA, QPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dedA (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dedB (B:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
    indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
    lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
    tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
    sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
    yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
    gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiaygstherwinndvii
    yerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilngntltvgaggaasnf
    tlapggtavwqyttdattpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgad
    ivawedtqiqvkipavpggiydirvanaagaasniydnfevltgdqvtvrfvinnattal
    gqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsvpagqtiefkflkkqgstv
    twegganrtfttptsgtatvnvnwqp