PDB entry 1deb

View 1deb on RCSB PDB site
Description: crystal structure of the n-terminal coiled coil domain from apc
Class: structural protein
Keywords: apc, coiled coil, tumor suppressor, structural protein
Deposited on 1999-11-14, released 2000-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adenomatous polyposis coli protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25054 (0-53)
  Domains in SCOPe 2.08: d1deba_
• Chain 'B':
  Compound: adenomatous polyposis coli protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25054 (Start-53)
  Domains in SCOPe 2.08: d1debb_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1debA (A:)
  aaasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1debB (B:)
  aaasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1debB (B:)
  aasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi