PDB entry 1deb

View 1deb on RCSB PDB site
Description: crystal structure of the n-terminal coiled coil domain from apc
Class: structural protein
Keywords: apc, coiled coil, tumor suppressor, structural protein
Deposited on 1999-11-14, released 2000-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenomatous polyposis coli protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deba_
  • Chain 'B':
    Compound: adenomatous polyposis coli protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1debb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1debA (A:)
    aaasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1debB (B:)
    aaasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1debB (B:)
    aasydqllkqvealkmensnlrqelednsnhltkleteasnmkevlkqlqgsi