PDB entry 1dea

View 1dea on RCSB PDB site
Description: structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution
Class: intramolecular oxidoreductase deaminase
Keywords: intramolecular oxidoreductase deaminase
Deposited on 1995-09-13, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine 6-phosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deaa_
  • Chain 'B':
    Compound: glucosamine 6-phosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1deab_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deaA (A:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1deaB (B:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl