PDB entry 1de9

View 1de9 on RCSB PDB site
Description: human ape1 endonuclease with bound abasic DNA and mn2+ ion
Class: lyase/DNA
Keywords: enzyme:DNA complex, DNA repair abasic site, ap endonuclease, lyase/DNA complex
Deposited on 1999-11-13, released 2000-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.183
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major apurinic/apyrimidinic endonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de9a_
  • Chain 'B':
    Compound: major apurinic/apyrimidinic endonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de9b_
  • Chain 'U':
    Compound: 5'-d(*CP*TP*AP*C)-3'
  • Chain 'V':
    Compound: 5'-d(P*(3DR)P*GP*AP*TP*C)-3'
  • Chain 'W':
    Compound: 5'-d(*GP*AP*TP*CP*GP*GP*TP*AP*G)-3'
  • Chain 'X':
    Compound: 5'-d(*CP*TP*AP*C)-3'
  • Chain 'Y':
    Compound: 5'-d(P*(3DR)P*GP*AP*TP*C)-3'
  • Chain 'Z':
    Compound: 5'-d(*GP*AP*TP*CP*GP*GP*TP*AP*G)-3'
  • Heterogens: MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de9A (A:)
    alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de9B (B:)
    alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.