PDB entry 1de8

View 1de8 on RCSB PDB site
Description: human apurinic/apyrimidinic endonuclease-1 (ape1) bound to abasic dna
Deposited on 1999-11-13, released 2000-02-02
The last revision prior to the SCOP 1.57 freeze date was dated 2000-02-02, with a file datestamp of 2000-02-02.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.19
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1de8a_
  • Chain 'B':
    Domains in SCOP 1.57: d1de8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de8A (A:)
    alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de8B (B:)
    alyedppdhktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
    klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
    dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
    pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
    dyfllshsllpalcdskirskalgsdhcpitlylal