PDB entry 1de6

View 1de6 on RCSB PDB site
Description: l-rhamnose isomerase
Class: isomerase
Keywords: (beta8/alpha8) barrel, tim barrel, hydride shift, isomerase
Deposited on 1999-11-13, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de6a_
  • Chain 'B':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de6b_
  • Chain 'C':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de6c_
  • Chain 'D':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1de6d_
  • Heterogens: RNS, ZN, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1de6A (A:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1de6A (A:)
    tqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpegsltggiqat
    gnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewa
    kanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvm
    niwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsn
    efymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvlld
    detqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallralleptaelrk
    leapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1de6B (B:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1de6B (B:)
    tqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpegsltggiqat
    gnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewa
    kanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvm
    niwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsn
    efymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvlld
    detqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallralleptaelrk
    leapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1de6C (C:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1de6C (C:)
    tqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpegsltggiqat
    gnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewa
    kanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvm
    niwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsn
    efymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvlld
    detqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallralleptaelrk
    leapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1de6D (D:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1de6D (D:)
    tqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpegsltggiqat
    gnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewa
    kanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvm
    niwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsn
    efymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvlld
    detqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallralleptaelrk
    leapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr