PDB entry 1de3

View 1de3 on RCSB PDB site
Description: solution structure of the cytotoxic ribonuclease alpha-sarcin
Deposited on 1999-11-12, released 2000-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1de3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de3A (A:)
    avtwtclndqknpktnkyetkrllynqnkaesnshhaplsdgktgssyphwftngydgdg
    klpkgrtpikfgksdcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgpa
    rviytypnkvfcgiiahtkenqgelklcsh