PDB entry 1de3

View 1de3 on RCSB PDB site
Description: solution structure of the cytotoxic ribonuclease alpha-sarcin
Class: hydrolase
Keywords: alpha-beta protein, hydrolase
Deposited on 1999-11-12, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease alpha-sarcin
    Species: Aspergillus giganteus [TaxId:5060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1de3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de3A (A:)
    avtwtclndqknpktnkyetkrllynqnkaesnshhaplsdgktgssyphwftngydgdg
    klpkgrtpikfgksdcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgpa
    rviytypnkvfcgiiahtkenqgelklcsh