PDB entry 1ddx

View 1ddx on RCSB PDB site
Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure
Deposited on 1999-11-11, released 2000-05-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-16, with a file datestamp of 2000-05-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.267
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddxA (A:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddxB (B:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddxC (C:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddxD (D:)
    anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpefltriklllkptpntvhyi
    lthfkgvwnivnnipflrslimkyvltsrsylidspptynvhygyksweafsnlsyytra
    lppvaddcptpmgvkgnkelpdskevlekvllrrefipdpqgsnmmfaffaqhfthqffk
    tdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgklkyqviggevypptvkdtqv
    emiypphipenlqfavgqevfglvpglmmyatiwlrehnrvcdilkqehpewgdeqlfqt
    srliligetikiviedyvqhlsgyhfklkfdpellfnqqfqyqnriasefntlyhwhpll
    pdtfniedqeysfkqflynnsillehgltqfvesftrqiagrvaggrnvpiavqavakas
    idqsremkyqslneyrkrfslkpytsfeeltgekemaaelkalysdidvmelypallvek
    prpdaifgetmvelgapfslkglmgnpicspqywkpstfggevgfkiintasiqslicnn
    vkgcpftsfnvq