PDB entry 1ddw

View 1ddw on RCSB PDB site
Description: homer evh1 domain unliganded
Class: signaling protein
Keywords: pleckstrin homology domain fold, signaling protein
Deposited on 1999-11-11, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glgf-domain protein homer
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Z214 (0-End)
      • modified residue (0)
      • modified residue (64)
    Domains in SCOPe 2.07: d1ddwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ddwA (A:)
    mgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinst
    itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddwA (A:)
    mgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinst
    itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaar