PDB entry 1ddv

View 1ddv on RCSB PDB site
Description: crystal structure of the homer evh1 domain with bound mglur peptide
Deposited on 1999-11-11, released 2000-05-10
The last revision prior to the SCOP 1.61 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.242
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ddva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddvA (A:)
    ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
    tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea