PDB entry 1ddv

View 1ddv on RCSB PDB site
Description: crystal structure of the homer evh1 domain with bound mglur peptide
Class: signaling protein
Keywords: protein-ligand complex, polyproline recognition, beta turn, signaling protein
Deposited on 1999-11-11, released 2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glgf-domain protein homer
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ddva_
  • Chain 'B':
    Compound: metabotropic glutamate receptor mglur5
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ddvA (A:)
    mgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinst
    itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddvA (A:)
    ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
    tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea
    

  • Chain 'B':
    No sequence available.