PDB entry 1ddv
View 1ddv on RCSB PDB site
Description: crystal structure of the homer evh1 domain with bound mglur peptide
Class: signaling protein
Keywords: protein-ligand complex, polyproline recognition, beta turn, signaling protein
Deposited on
1999-11-11, released
2000-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: glgf-domain protein homer
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ddva_ - Chain 'B':
Compound: metabotropic glutamate receptor mglur5
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1ddvA (A:)
mgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinst
itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaar
Sequence, based on observed residues (ATOM records): (download)
>1ddvA (A:)
ifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinstitpnm
tftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkea
- Chain 'B':
No sequence available.