PDB entry 1ddt

View 1ddt on RCSB PDB site
Description: the refined structure of dimeric diphtheria toxin at 2.0 angstroms resolution
Class: toxin
Keywords: toxin
Deposited on 1994-03-01, released 1994-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin
    Species: Corynephage beta [TaxId:10703]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ddta1, d1ddta2, d1ddta3
  • Heterogens: APU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ddtA (A:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddtA (A:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacascinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhq
    talehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigs
    vmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvh
    nsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagv
    llptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafh
    rsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks