PDB entry 1ddq

View 1ddq on RCSB PDB site
Description: crystal structure of thermus aquaticus core rna polymerase at 3.3 a resolution
Deposited on 1999-11-11, released 2000-01-28
The last revision was dated 2003-04-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.329
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus
  • Chain 'B':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus
  • Chain 'C':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus
  • Chain 'D':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus
  • Chain 'E':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus
  • Heterogens: MG, ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ddqA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadve
    imnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqv
    edtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevskg
    ekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigersleei
    rqalakkgftlke
    

    Sequence, based on observed residues (ATOM records):
    >1ddqA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveimnpd
    lhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtrl
    gqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ddqB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadve
    imnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqv
    edtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevskg
    ekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigersleei
    rqalakkgftlke
    

    Sequence, based on observed residues (ATOM records):
    >1ddqB (B:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadveimnpd
    lhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtrl
    gqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ddqC (C:)
    mkikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmigleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
    seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
    kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
    eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
    vpesfrvlvkelqalaldvqlldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records):
    >1ddqC (C:)
    kikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkgk
    gglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplm
    tedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgv
    vtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlftl
    lrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkde
    vflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermvm
    gspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltre
    ragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvte
    evvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvfs
    lntnlipflehddanralmgsnmqtqavpliraqapvvmigleervvrdslaalyaeedg
    evvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpas
    eegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgper
    itrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgek
    ardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklan
    rhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqry
    ispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspee
    qlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqpl
    ggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsv
    pesfrvlvkelqalaldvqlldekdnpvdife
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1ddqD (D:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgnrpewmileavpvlppdlr
    pmvqvdggrfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidng
    rrgspvtnpgserplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglp
    krmalelfkpfllkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnra
    ptlhrlgiqafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmls
    ahnllspasgeplakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalna
    pivvagretsvgrlkfvfanpdeallavahglldlqdvvtvrylgrrletnpgrilfari
    vgeavgdekvaqeliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlstts
    giitigiddavipeekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvt
    qavfnnfeenypfnplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfreg
    ltvleyfisshgarkggadtalrtadsgyltrklvdvaheivvreadcgttkyisvplfq
    mdevtrtlrlrkrsdiesglygrvlarevealgrrleegrylsledvhflikaaeagevr
    evpvrspltcqtrygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtg
    gvavgtditqglprvielfearrpkakaviseidgvvrieegedrlsvfvesegfskeyk
    lpkdarllvkdgdyveagqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklh
    dkhieivvrqmlkyvevtdpgdspllegqvlekwdvealnerliaegkvpvawkpllmgv
    tksalstkswlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrft
    qvvdqrtl
    

    Sequence, based on observed residues (ATOM records):
    >1ddqD (D:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxgnrpewmileavpvlppdfa
    tsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgs
    erplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpf
    llkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqaf
    qpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasge
    plakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsv
    grlkfvfanpdeallavahglldlqdvvtvrylgrrletnpgrilfarivgeavgdekva
    qeliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgiitigiddav
    ipeekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfnnfeeny
    pfnplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfissh
    garkggadtalrtadsgyltrklvdvaheivvreadcgttkyisvplfqmdevtrtlrlr
    krsdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcq
    trygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtditqg
    lprvielfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkd
    gdyveagqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqm
    lkyvevtdpgdspllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswl
    saasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1ddqE (E:)
    xxpgidxlfgxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxexxxxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx