PDB entry 1ddo

View 1ddo on RCSB PDB site
Description: reduced d-amino acid oxidase from pig kidney in complex with imino-trp
Deposited on 1997-01-16, released 1997-07-23
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.236
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoA (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoB (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoC (C:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoD (D:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoE (E:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoF (F:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoG (G:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddoH (H:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl