PDB entry 1ddm

View 1ddm on RCSB PDB site
Description: solution structure of the numb ptb domain complexed to a nak peptide
Deposited on 1999-11-11, released 2000-04-10
The last revision prior to the SCOP 1.69 freeze date was dated 2000-04-12, with a file datestamp of 2000-04-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ddma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ddmA (A:)
hqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhvsgd
glrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackdsger
lshavgcafavcler