PDB entry 1ddm

View 1ddm on RCSB PDB site
Description: solution structure of the numb ptb domain complexed to a nak peptide
Class: signaling protein/transferase
Keywords: complex, signal transduction, phosphotyrosine binding domain (ptb), asymmetric cell division, signaling protein/transferase complex
Deposited on 1999-11-11, released 2000-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: numb protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ddma_
  • Chain 'B':
    Compound: numb associate kinase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DDM (0-10)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ddmA (A:)
hqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhvsgd
glrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackdsger
lshavgcafavcler

  • Chain 'B':
    No sequence available.