PDB entry 1ddl

View 1ddl on RCSB PDB site
Description: desmodium yellow mottle tymovirus
Class: Virus/RNA
Keywords: PLANT VIRUS, DYMV, CAPSID PROTEIN, COAT PROTEIN, TYMOVIRUSES, WATER STRUCTURE, RNA, Icosahedral virus, Virus/RNA COMPLEX
Deposited on 1999-11-10, released 2000-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.151
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desmodium yellow mottle virus
    Species: Desmodium yellow mottle virus [TaxId:70821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ddla_
  • Chain 'B':
    Compound: desmodium yellow mottle virus
    Species: Desmodium yellow mottle virus [TaxId:70821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ddlb_
  • Chain 'C':
    Compound: desmodium yellow mottle virus
    Species: Desmodium yellow mottle virus [TaxId:70821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ddlc_
  • Chain 'D':
    Compound: RNA (5'-r(p*up*up*up*up*up*up*u)-3')
  • Chain 'E':
    Compound: RNA (5'-r(p*up*u)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddlA (A:)
    meqdkilahqaslntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvla
    tytalyrhaqlkhlkatihptymapkyptsvalvwvpanstatstqvldtygglhfcigg
    svnsvkpidveanltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqiels
    spllqass
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddlB (B:)
    meqdkilahqaslntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvla
    tytalyrhaqlkhlkatihptymapkyptsvalvwvpanstatstqvldtygglhfcigg
    svnsvkpidveanltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqiels
    spllqass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ddlC (C:)
    meqdkilahqaslntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvla
    tytalyrhaqlkhlkatihptymapkyptsvalvwvpanstatstqvldtygglhfcigg
    svnsvkpidveanltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqiels
    spllqass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddlC (C:)
    ntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvlatytalyrhaqlkh
    lkatihptymapkyptsvalvwvpanstatstqvldtygglhfciggsvnsvkpidvean
    ltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqielsspllqass
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.