PDB entry 1ddk

View 1ddk on RCSB PDB site
Description: crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
Class: hydrolase
Keywords: imp-1 metallo beta-lactamase, binuclear metal center, zn beta-lactamase, hydrolase
Deposited on 1999-11-10, released 2000-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: imp-1 metallo beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ddka_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddkA (A:)
    eslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvt
    wfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgv
    nywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksak
    llkskygkaklvvpshsevgdasllkltleqavkglnesk