PDB entry 1ddi

View 1ddi on RCSB PDB site
Description: crystal structure of sir-fp60
Class: oxidoreductase
Keywords: cytochrome p450 reductase, fnr, flavoprotein, modular protein, oxidoreductase
Deposited on 1999-11-10, released 2000-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.185
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfite reductase [nadph] flavoprotein alpha-component
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ddia1, d1ddia2
  • Heterogens: FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddiA (A:)
    ihtspyskdaplvaslsvnqkitgrnsekdvrhieidlgdsglryqpgdalgvwyqndpa
    lvkelvellwlkgdepvtvegktlplnealqwhfeltvntanivenyatltrsetllplv
    gdkaklqhyaattpivdmvrfspaqldaealinllrpltprlysiassqaevenevhvtv
    gvvrydvegraraggassfladrveeegevrvfiehndnfrlpanpetpvimigpgtgia
    pfrafmqqraadeapgknwlffgnphftedflyqvewqryvkegvltridlawsrdqkek
    vyvqdklreqgaelwrwindgahiyvcgdanrmakdveqalleviaefggmdteaadefl
    selrverryqrdvy