PDB entry 1ddh

View 1ddh on RCSB PDB site
Description: MHC class I h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120
Class: complex (histocompatibility/antigen)
Keywords: complex (histocompatibility/antigen), histocompatibility antigen, class I major histocompatibility complex, MHC I, peptide
Deposited on 1998-06-22, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I h-2dd heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01900 (1-273)
      • conflict (67)
      • conflict (180)
      • conflict (211)
      • conflict (253)
    Domains in SCOPe 2.07: d1ddha1, d1ddha2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (1-98)
      • conflict (84)
    Domains in SCOPe 2.07: d1ddhb_
  • Chain 'P':
    Compound: human immunodeficiency virus envelope glycoprotein 120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddhA (A:)
    mshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
    eretrrangneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
    atdppkahvthhrrpegdvtlrcwalgfypaeitltwqlngeeltqemelvetrpagdgt
    fqkwasvvvplgkqqkytchveheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddhB (B:)
    mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhasmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.