PDB entry 1ddh
View 1ddh on RCSB PDB site
Description: MHC class I h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120
Class: complex (histocompatibility/antigen)
Keywords: complex (histocompatibility/antigen), histocompatibility antigen, class I major histocompatibility complex, MHC I, peptide
Deposited on
1998-06-22, released
1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.17
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: MHC class I h-2dd heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P01900 (1-273)
- conflict (67)
- conflict (180)
- conflict (211)
- conflict (253)
Domains in SCOPe 2.07: d1ddha1, d1ddha2 - Chain 'B':
Compound: beta-2 microglobulin
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1ddhb_ - Chain 'P':
Compound: human immunodeficiency virus envelope glycoprotein 120
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ddhA (A:)
mshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
eretrrangneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
atdppkahvthhrrpegdvtlrcwalgfypaeitltwqlngeeltqemelvetrpagdgt
fqkwasvvvplgkqqkytchveheglpepltlrw
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ddhB (B:)
mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhasmaepktvywdrdm
- Chain 'P':
No sequence available.