PDB entry 1ddh

View 1ddh on RCSB PDB site
Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120
Deposited on 1998-06-22, released 1999-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddhA (A:)
    mshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
    eretrrangneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
    cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
    atdppkahvthhrrpegdvtlrcwalgfypaeitltwqlngeeltqemelvetrpagdgt
    fqkwasvvvplgkqqkytchveheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddhB (B:)
    mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhasmaepktvywdrdm