PDB entry 1ddf

View 1ddf on RCSB PDB site
Description: fas death domain, nmr, minimized average structure
Deposited on 1996-11-08, released 1997-11-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ddf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ddf_ (-)
    metvainlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvq
    llrnwhqlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvl
    ehhhhhh