PDB entry 1ddc

View 1ddc on RCSB PDB site
Description: dimeric di-heme split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774
Deposited on 1997-07-16, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ddca_
  • Chain 'B':
    Domains in SCOP 1.55: d1ddcb_
  • Chain 'C':
    Domains in SCOP 1.55: d1ddcc_
  • Chain 'D':
    Domains in SCOP 1.55: d1ddcd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ddcA (A:)
    rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
    famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
    aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
    kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddcA (A:)
    rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
    amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
    aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
    dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ddcB (B:)
    rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
    famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
    aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
    kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddcB (B:)
    rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
    amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
    aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
    dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ddcC (C:)
    rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
    famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
    aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
    kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddcC (C:)
    rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
    amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
    aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
    dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ddcD (D:)
    rfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfp
    famleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgd
    aaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrseragrltadaafkaaeiint
    kidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ddcD (D:)
    rfdqvggafgwphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqfpf
    amleankggisdwgtiygalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpgda
    aqgvkgdlpmsasdsvlchisvskwcyenkieatkqrseragrltadaafkaaeiintki
    dqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnh