PDB entry 1dd9

View 1dd9 on RCSB PDB site
Description: structure of the dnag catalytic core
Class: transferase
Keywords: toprim, 3-helix bundle, DNA-binding protein, RNA polymerase, replication protein, primase, transferase
Deposited on 1999-11-09, released 2000-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.231
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd9a_
  • Heterogens: SR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dd9A (A:)
    mrgshhhhhhgsgsmhqrqtlyqlmdglntfyqqslqqpvatsarqylekrglsheviar
    faigfappgwdnvlkrfggnpenrqslidagmlvtndqgrsydrfrervmfpirdkrgrv
    igfggrvlgndtpkylnspetdifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaq
    yginyavaslgtsttadhiqllfratnnviccydgdragrdaawraletalpymtdgrql
    rfmflpdgedpdtlvrkegkeafearmeqamplsaflfnslmpqvdlstpdgrarlstla
    lplisqvpgetlriylrqelgnklgilddsqlerlmpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd9A (A:)
    tlyqlmdglntfyqqslqqpvatsarqylekrglsheviarfaigfappgwdnvlkrfgg
    npenrqslidagmlvtnrsydrfrervmfpirdkrgrvigfggrvlgndtpkylnspetd
    ifhkgrqlyglyeaqqdnaepnrllvvegymdvvalaqyginyavaslgsttadhiqllf
    ratnnviccydgdragrdaawraletalpymtdgrqlrfmflpdgedpdtlvrkegkeaf
    earmeqamplsaflfnslmpqvdlstpdgrarlstlalplisqvpgetlriylrqelgnk
    lgilddsqle