PDB entry 1dd7

View 1dd7 on RCSB PDB site
Description: murine inducible nitric oxide synthase oxygenase domain (delta 114) (n-[(1,3-benzodioxol-5-yl)methyl]-1-[2-(1h-imidazol-1-yl)pyrimidin-4-yl]-4-(methoxycarbonyl)-piperazine-2-acetamide complex
Class: oxidoreductase
Keywords: nitric oxide, l-arginine monooxygenase, heme, dimerization, inhibitor, nos, oxidoreductase
Deposited on 1999-11-08, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inducible nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd7a_
  • Heterogens: SO3, HEM, 1PM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dd7A (A:)
    mnpksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgty
    qltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngn
    irsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkpry
    grfdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllev
    gglefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravtein
    vavlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqe
    mlnyvlspfyyyqiepwkthiwqnehhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd7A (A:)
    mnpksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgty
    qltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngn
    irsaitvfpqrsdgkhdfrlwnsqliryagyqtirgdaatleftqlcidlgwkprygrfd
    vlplvlqadgqdpevfeippdlvlevtmelglkwyalpavanmllevgglefpacpfngw
    ymnvavlhsfqkqnvtimdhhtasesfmkhmqneyvlspfyyyqiepwkthiwqn