PDB entry 1dd6

View 1dd6 on RCSB PDB site
Description: imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a mercaptocarboxylate inhibitor
Class: hydrolase
Keywords: metallo beta-lactamase inhibitor, mercaptocarboxylate inhibitor, imp-1 metallo beta-lactamase, hydrolase
Deposited on 1999-11-08, released 2000-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: imp-1 metallo beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd6a_
  • Chain 'B':
    Compound: imp-1 metallo beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd6b_
  • Heterogens: SO4, ZN, MCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dd6A (A:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd6A (A:)
    lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
    vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
    wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
    kskygkaklvvpshsevgdasllkltleqavkglne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dd6B (B:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd6B (B:)
    lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
    vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
    wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
    kskygkaklvvpshsevgdasllkltleqavkglnes