PDB entry 1dd1

View 1dd1 on RCSB PDB site
Description: crystal structure analysis of the smad4 active fragment
Class: signaling protein
Keywords: b-sheet sandwich helix-turn-helix, signaling protein
Deposited on 1999-11-05, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd1a_
  • Chain 'B':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd1b_
  • Chain 'C':
    Compound: smad4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dd1c_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dd1A (A:)
    nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
    cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
    havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
    vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdyprqsiketpcw
    ieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd1A (A:)
    nghlqhhppmppqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsg
    gdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldrea
    grapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaaagigvddlrrlcilrms
    fvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dd1B (B:)
    nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
    cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
    havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
    vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdyprqsiketpcw
    ieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd1B (B:)
    nghlqhhppmppelafqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyv
    dpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyl
    dreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaavagniapais
    lsaaagigvddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtm
    piadpqpld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dd1C (C:)
    nghlqhhppmpphpghywpvhnelafqppisnhpapeywcsiayfemdvqvgetfkvpss
    cpivtvdgyvdpsggdrfclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsd
    havfvqsyyldreagrapgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaa
    vagnipgpgsvggiapaislsaaagigvddlrrlcilrmsfvkgwgpdyprqsiketpcw
    ieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dd1C (C:)
    nghlqhhppmppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdr
    fclgqlsnvhrteaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagra
    pgdavhkiypsayikvfdlrqchrqmqqqaataqaaaaaqaaavagnapaislsaaagig
    vddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpqpl
    d