PDB entry 1dcu

View 1dcu on RCSB PDB site
Description: redox signaling in the chloroplast: structure of oxidized pea fructose-1,6-bisphosphate phosphatase
Class: hydrolase
Keywords: chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase
Deposited on 1999-11-05, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46275 (Start-356)
      • engineered (102)
      • engineered (231)
    Domains in SCOPe 2.07: d1dcua_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46275 (Start-356)
      • engineered (102)
      • engineered (231)
    Domains in SCOPe 2.07: d1dcub_
  • Chain 'C':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46275 (Start-356)
      • engineered (102)
      • engineered (231)
    Domains in SCOPe 2.07: d1dcuc_
  • Chain 'D':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46275 (Start-356)
      • engineered (102)
      • engineered (231)
    Domains in SCOPe 2.07: d1dcud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcuA (A:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcuA (A:)
    krsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgtedqk
    kldvisnevfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavs
    tgsifgiyspndeclpntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvf
    vftldplygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysa
    ryigslvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrv
    ldiqpteihqrvplyigsteevekvekyla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dcuB (B:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcuB (B:)
    eiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnledqkkldvisne
    vfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgiy
    spndeclpdntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftldpl
    ygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigslv
    gdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqpte
    ihqrvplyigsteevekvekyla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dcuC (C:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcuC (C:)
    yeiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltedqkkldvis
    nevfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifg
    iyspndeclpdfddntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvf
    tldplygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysary
    igslvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvld
    iqpteihqrvplyigsteevekvekyla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dcuD (D:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcuD (D:)
    eiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgedqkkldvis
    nevfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifg
    iyspndeclpdntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftld
    plygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigs
    lvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqp
    teihqrvplyigsteevekvekyla