PDB entry 1dcs

View 1dcs on RCSB PDB site
Description: deacetoxycephalosporin c synthase from s. clavuligerus
Class: oxidoreductase
Keywords: ferrous oxygenase, cephalosporin, 2-oxoglutarate, oxidoreductase, antibiotics, merohedral twinning, antibiotic biosynthesis
Deposited on 1998-06-05, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.129
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deacetoxycephalosporin c synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcsa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcsA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
    aekravtspvptmrrgftglesestaqitntgsysdysmcysmgtadnlfpsgdferiwt
    qyfdrqytasravarevlratgtepdggveafldcepllrfryfpqvpehrsaeeqplrm
    aphydlsmvtliqqtpcangfvslqaevggaftdlpyrpdavlvfcgaiatlvtggqvka
    prhhvaaprrdqiagssrtssvfflrpnadftfsvplarecgfdvsldgetatfqdwigg
    nyvnirrtska
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcsA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
    aekravtspvptmrrgftglsmcysmgtadnlfpsgdferiwtqyfdrqytasravarev
    lratgtepdggveafldcepllrfryfpqlrmaphydlsmvtliqqtpcangfvslqaev
    ggaftdlpyrpdavlvfcgaiatlvtggqvkaprhhvaapiagssrtssvfflrpnadft
    fsvplarecgfdvsldgetatfqdwiggnyvnirrtska