PDB entry 1dcp

View 1dcp on RCSB PDB site
Description: dcoh, a bifunctional protein-binding transcriptional coactivator, complexed with biopterin
Deposited on 1996-05-16, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dcpa_
  • Chain 'B':
    Domains in SCOP 1.55: d1dcpb_
  • Chain 'C':
    Domains in SCOP 1.55: d1dcpc_
  • Chain 'D':
    Domains in SCOP 1.55: d1dcpd_
  • Chain 'E':
    Domains in SCOP 1.55: d1dcpe_
  • Chain 'F':
    Domains in SCOP 1.55: d1dcpf_
  • Chain 'G':
    Domains in SCOP 1.55: d1dcpg_
  • Chain 'H':
    Domains in SCOP 1.55: d1dcph_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpA (A:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpB (B:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpC (C:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpD (D:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpE (E:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpF (F:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpG (G:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcpH (H:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt