PDB entry 1dco

View 1dco on RCSB PDB site
Description: dcoh, a bifunctional protein-binding transcriptional coactivator
Class: transcriptional stimulator
Keywords: transcriptional stimulator, dimerization cofactor, dehydratase, 4a-carbinolamine dehydratase, transregulator of homeodomain proteins
Deposited on 1996-05-16, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcoa_
  • Chain 'B':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcob_
  • Chain 'C':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcoc_
  • Chain 'D':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcod_
  • Chain 'E':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcoe_
  • Chain 'F':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcof_
  • Chain 'G':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcog_
  • Chain 'H':
    Compound: dcoh
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcoh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcoA (A:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoA (A:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dcoB (B:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoB (B:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dcoC (C:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoC (C:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dcoD (D:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoD (D:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1dcoE (E:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoE (E:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1dcoF (F:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoF (F:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1dcoG (G:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoG (G:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dcoH (H:)
    magkahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekl
    dhhpewfnvynkvhitlsthecaglserdinlasfieqvavsmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcoH (H:)
    hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
    wfnvynkvhitlsthecaglserdinlasfieqvavsmt