PDB entry 1dcn

View 1dcn on RCSB PDB site
Description: inactive mutant h162n of delta 2 crystallin with bound argininosuccinate
Deposited on 1998-10-29, released 1999-04-27
The last revision prior to the SCOP 1.59 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dcna_
  • Chain 'B':
    Domains in SCOP 1.59: d1dcnb_
  • Chain 'C':
    Domains in SCOP 1.59: d1dcnc_
  • Chain 'D':
    Domains in SCOP 1.59: d1dcnd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcnA (A:)
    dqrlsevdiqgsmayakalekagiltktelakilsglekiseewskgvfvvkgsdediht
    anerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllqliktlveraaie
    idvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlplgsgalagnpld
    idremlrselefasislnsmdaiserdfvveflsfatllmihlskmaedliiystsefgf
    ltlsdafstnpdslelirsksgrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtl
    tavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqahtasgkavhlae
    tkgitinnlsledlksispqfssdvsqvfnfvnsveqytalggtakssvttqieqlrelm
    kkqk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcnB (B:)
    dpimaklnssiaydqrlsevdiqgsmayakalekagiltktelakilsglekiseediht
    anerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllqliktlveraaie
    idvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlplgsgalagnpld
    idremlrselefasislnsmdaiserdfvveflsfatllmihlskmaedliiystsefgf
    ltlspdslelirsksgrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqv
    atgvistlqiskenmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgiti
    nnlsledlksispqfssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcnC (C:)
    tdpimaklnssiaydqrlsevdiqgsmayakalekagiltktelakilsglekiseewsk
    gvfvvkgsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdapdslelirsksgrvfgrlasilmvlkglpstynkdlqedk
    eavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqaht
    asgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalggtakssvt
    tqieqlrelmkkqk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcnD (D:)
    pimaklnssiaydqrlsevdiqgsmayakalekagiltktelakilsglekiseewskgv
    fvvkgsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllq
    liktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlp
    lgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskmae
    dliiystsefgfltlsdafstnpdslelirsksgrvfgrlasilmvlkglpstynkdlqe
    dkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqa
    htasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalggtakss
    vttqieqlrelmkkqk