PDB entry 1dcn

View 1dcn on RCSB PDB site
Description: inactive mutant h162n of delta 2 crystallin with bound argininosuccinate
Class: eye lens protein
Keywords: eye lens protein, delta 2 crystallin, argininosuccinate lyase
Deposited on 1998-10-29, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058 (Start-446)
      • conflict (91)
      • engineered (143)
      • conflict (283)
      • conflict (390)
    Domains in SCOPe 2.07: d1dcna_
  • Chain 'B':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058 (Start-446)
      • conflict (91)
      • engineered (143)
      • conflict (283)
      • conflict (390)
    Domains in SCOPe 2.07: d1dcnb_
  • Chain 'C':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058 (0-446)
      • conflict (91)
      • engineered (143)
      • conflict (283)
      • conflict (390)
    Domains in SCOPe 2.07: d1dcnc_
  • Chain 'D':
    Compound: delta 2 crystallin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24058 (Start-446)
      • conflict (91)
      • engineered (143)
      • conflict (283)
      • conflict (390)
    Domains in SCOPe 2.07: d1dcnd_
  • Heterogens: AS1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcnA (A:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcnA (A:)
    dqrlsevdiqgsmayakalekagiltktelekilsglekiseewskgvfvvkqsdediht
    anerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllqliktlveraaie
    idvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlplgsgalagnpld
    idremlrselefasislnsmdaiserdfvveflsfatllmihlskmaedliiystsefgf
    ltlsdafstnpdslelirsksgrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtl
    tavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqahtasgkavhlae
    tkgitinnlsledlksispqfssdvsqvfnfvnsveqytalagtakssvttqieqlrelm
    kkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dcnB (B:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcnB (B:)
    dpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseediht
    anerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllqliktlveraaie
    idvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlplgsgalagnpld
    idremlrselefasislnsmdaiserdfvveflsfatllmihlskmaedliiystsefgf
    ltlspdslelirsksgrvfgrlasilmvlkglpstynkdlqedkeavfdvvdtltavlqv
    atgvistlqiskenmekaltpemlatdlalylvrkgvpfrqahtasgkavhlaetkgiti
    nnlsledlksispqfssdvsqvfnfvnsveqytalagtakssvttqieqlrelmkkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dcnC (C:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcnC (C:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdapdslelirsksgrvfgrlasilmvlkglpstynkdlqedk
    eavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqaht
    asgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalagtakssvt
    tqieqlrelmkkqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dcnD (D:)
    tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkg
    lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgvpfrqahtasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveq
    ytalagtakssvttqieqlrelmkkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcnD (D:)
    pimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewskgv
    fvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllq
    liktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlp
    lgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskmae
    dliiystsefgfltlsdafstnpdslelirsksgrvfgrlasilmvlkglpstynkdlqe
    dkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqa
    htasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalagtakss
    vttqieqlrelmkkqk