PDB entry 1dcj

View 1dcj on RCSB PDB site
Description: solution structure of yhhp, a novel escherichia coli protein implicated in the cell division
Class: structural genomics, unknown function
Keywords: alpha-beta sandwich, structural genomics
Deposited on 1999-11-05, released 2001-07-18
The last revision prior to the SCOP 1.75 freeze date was dated 2001-09-11, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: yhhp protein
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A890 (0-80)
  Domains in SCOP 1.75: d1dcja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dcjA (A:)
  mtdlfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfme
  helvaketdglpyrylirkgg