PDB entry 1dcj

View 1dcj on RCSB PDB site
Description: solution structure of yhhp, a novel escherichia coli protein implicated in the cell division
Deposited on 1999-11-05, released 2001-07-18
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-11, with a file datestamp of 2001-09-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dcja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcjA (A:)
    mtdlfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfme
    helvaketdglpyrylirkgg