PDB entry 1dcj

View 1dcj on RCSB PDB site
Description: solution structure of yhhp, a novel escherichia coli protein implicated in the cell division
Class: structural genomics, unknown function
Keywords: alpha-beta sandwich, structural genomics, unknown function
Deposited on 1999-11-05, released 2001-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yhhp protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcjA (A:)
    mtdlfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfme
    helvaketdglpyrylirkgg