PDB entry 1dci

View 1dci on RCSB PDB site
Description: dienoyl-coa isomerase
Class: lyase
Keywords: lyase, dienoyl-coa isomerase
Deposited on 1998-02-13, released 1999-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dienoyl-coa isomerase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcia_
  • Chain 'B':
    Compound: dienoyl-coa isomerase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcib_
  • Chain 'C':
    Compound: dienoyl-coa isomerase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcic_
  • Heterogens: SO4, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dciA (A:)
    ayesiqvtsaqkhvlhvqlnrpekrnamnrafwrelvecfqkiskdsdcravvvsgagkm
    ftsgidlmdmasdilqppgddvariawylrdlisryqktftviekcpkpviaaihggcig
    ggvdlisacdiryctqdaffqvkevdvglaadvgtlqrlpkvignrslvneltftarkmm
    adealdsglvsrvfpdkdvmlnaafalaadisskspvavqgskinliysrdhsvdesldy
    matwnmsmlqtqdiiksvqaamekkdsksitfskl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dciB (B:)
    ayesiqvtsaqkhvlhvqlnrpekrnamnrafwrelvecfqkiskdsdcravvvsgagkm
    ftsgidlmdmasdilqppgddvariawylrdlisryqktftviekcpkpviaaihggcig
    ggvdlisacdiryctqdaffqvkevdvglaadvgtlqrlpkvignrslvneltftarkmm
    adealdsglvsrvfpdkdvmlnaafalaadisskspvavqgskinliysrdhsvdesldy
    matwnmsmlqtqdiiksvqaamekkdsksitfskl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dciC (C:)
    ayesiqvtsaqkhvlhvqlnrpekrnamnrafwrelvecfqkiskdsdcravvvsgagkm
    ftsgidlmdmasdilqppgddvariawylrdlisryqktftviekcpkpviaaihggcig
    ggvdlisacdiryctqdaffqvkevdvglaadvgtlqrlpkvignrslvneltftarkmm
    adealdsglvsrvfpdkdvmlnaafalaadisskspvavqgskinliysrdhsvdesldy
    matwnmsmlqtqdiiksvqaamekkdsksitfskl