PDB entry 1dcf

View 1dcf on RCSB PDB site
Description: crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana
Deposited on 1999-11-04, released 2000-01-04
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-10, with a file datestamp of 2000-01-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dcfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dcfA (A:)
    hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
    pgvenyqialrihekftkqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnir
    dvlsdlleprvlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dcfA (A:)
    hmsnftglkvlvmdengvsrmvtkgllvhlgcevttvssneeclrvvshehkvvfmdvcm
    pgvenyqialrihekftqrhqrpllvalsgntdkstkekcmsfgldgvllkpvsldnird
    vlsdlleprvlye