PDB entry 1dce

View 1dce on RCSB PDB site
Description: crystal structure of rab geranylgeranyltransferase from rat brain
Class: transferase
Keywords: crystal structure, rab geranylgeranyltransferase, 2.0 a resolution, n-formylmethionine, alpha subunit, beta subunit
Deposited on 1999-11-04, released 2000-03-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (rab geranylgeranyltransferase alpha subunit)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (0-566)
      • modified residue (0)
    Domains in SCOPe 2.06: d1dcea1, d1dcea2, d1dcea3
  • Chain 'B':
    Compound: protein (rab geranylgeranyltransferase beta subunit)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dceb_
  • Chain 'C':
    Compound: protein (rab geranylgeranyltransferase alpha subunit)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (0-566)
      • modified residue (0)
    Domains in SCOPe 2.06: d1dcec1, d1dcec2, d1dcec3
  • Chain 'D':
    Compound: protein (rab geranylgeranyltransferase beta subunit)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dced_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dceA (A:)
    mhgrlkvktseeqaeakrlereqklklyqsatqavfqkrqageldesvleltsqilganp
    dfatlwncrrevlqhletekspeesaalvkaelgflesclrvnpksygtwhhrcwllsrl
    pepnwarelelcarfleadernfhcwdyrrfvaaqaavapaeelaftdslitrnfsnyss
    whyrscllpqlhpqpdsgpqgrlpenvllkelelvqnafftdpndqsawfyhrwllgrae
    phdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvw
    lcdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeqlfrcelsvek
    stvlqselesckelqelepenkwclltiillmraldpllyeketlqyfstlkavdpmraa
    ylddlrskfllensvlkmeyadvrvlhlahkdltvlchleqlllvthldlshnrlralpp
    alaalrclevlqasdnalenvdgvanlprlqelllcnnrlqqsaaiqplvscprlvllnl
    qgnslcqeegiqerlaemlpsvssilt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dceB (B:)
    mgtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlm
    gqlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvv
    ayvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdgg
    fgcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvc
    yswwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsl
    lgeeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dceB (B:)
    tqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgq
    lhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvay
    vqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfg
    crpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcys
    wwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllg
    eeqikpvspvfcmpeevlqrvnvqpelvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dceC (C:)
    mhgrlkvktseeqaeakrlereqklklyqsatqavfqkrqageldesvleltsqilganp
    dfatlwncrrevlqhletekspeesaalvkaelgflesclrvnpksygtwhhrcwllsrl
    pepnwarelelcarfleadernfhcwdyrrfvaaqaavapaeelaftdslitrnfsnyss
    whyrscllpqlhpqpdsgpqgrlpenvllkelelvqnafftdpndqsawfyhrwllgrae
    phdvlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvw
    lcdlpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeqlfrcelsvek
    stvlqselesckelqelepenkwclltiillmraldpllyeketlqyfstlkavdpmraa
    ylddlrskfllensvlkmeyadvrvlhlahkdltvlchleqlllvthldlshnrlralpp
    alaalrclevlqasdnalenvdgvanlprlqelllcnnrlqqsaaiqplvscprlvllnl
    qgnslcqeegiqerlaemlpsvssilt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dceD (D:)
    mgtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlm
    gqlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvv
    ayvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdgg
    fgcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvc
    yswwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsl
    lgeeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dceD (D:)
    tqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgq
    lhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvay
    vqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfg
    crpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcys
    wwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllg
    eeqikpvspvfcmpeevlqrvnvqpelvs