PDB entry 1dcd

View 1dcd on RCSB PDB site
Description: desulforedoxin complexed with cd2+
Deposited on 1999-03-20, released 1999-07-09
The last revision prior to the SCOP 1.59 freeze date was dated 1999-07-09, with a file datestamp of 1999-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dcda_
  • Chain 'B':
    Domains in SCOP 1.59: d1dcdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcdA (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcdB (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq