PDB entry 1dcd

View 1dcd on RCSB PDB site
Description: desulforedoxin complexed with cd2+
Class: electron transport
Keywords: rubredoxin type protein, electron transport
Deposited on 1999-03-20, released 1999-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (desulforedoxin)
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcda_
  • Chain 'B':
    Compound: protein (desulforedoxin)
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dcdb_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcdA (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dcdB (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq