PDB entry 1dc9

View 1dc9 on RCSB PDB site
Description: properties and crystal structure of a beta-barrel folding mutant, v60n intestinal fatty acid binding protein (ifabp)
Class: lipid binding protein
Keywords: fatty acid binding protein, intracellular lipid binding protein, mutant, beta- barrel, lipid binding protein
Deposited on 1999-11-04, released 2000-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: intestinal fatty acid binding protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02693 (0-130)
    • engineered (59)
  Domains in SCOPe 2.08: d1dc9a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dc9A (A:)
  afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidn
  vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
  gveakrifkke