PDB entry 1dc8

View 1dc8 on RCSB PDB site
Description: structure of a transiently phosphorylated "switch" in bacterial signal transduction
Class: signaling protein
Keywords: receiver domain, phosphorylation, signal transduction, conformational rearrangement, two-component system, signaling protein
Deposited on 1999-11-04, released 2000-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulation protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41789 (0-123)
      • autophosphorylation (53)
    Domains in SCOPe 2.07: d1dc8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dc8A (A:)
    mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
    dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
    hyqe