PDB entry 1dc7

View 1dc7 on RCSB PDB site
Description: structure of a transiently phosphorylated "switch" in bacterial signal transduction
Class: signaling protein
Keywords: receiver domain, phosphorylation, signal transduction, conformational rearrangement, two-component system, signaling protein
Deposited on 1999-11-04, released 2000-01-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nitrogen regulation protein
  Species: Salmonella typhimurium [TaxId:602]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41789 (0-123)
  Domains in SCOPe 2.06: d1dc7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dc7A (A:)
  mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
  dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
  hyqe