PDB entry 1dc6

View 1dc6 on RCSB PDB site
Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes.
Class: oxidoreductase
Keywords: gapdh, structure, cofactor
Deposited on 1999-11-04, released 2000-08-23
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dc6a1, d1dc6a2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1dc6b1, d1dc6b2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dc6A (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dc6B (B:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk