PDB entry 1dc2

View 1dc2 on RCSB PDB site
Description: solution nmr structure of tumor suppressor p16ink4a, 20 structures
Class: gene regulation
Keywords: ankyrin repeat, helix-turn-helix, helix bundle, gene regulation
Deposited on 1999-11-04, released 1999-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cyclin-dependent kinase 4 inhibitor a (p16ink4a)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42771 (0-155)
  Domains in SCOPe 2.08: d1dc2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dc2A (A:)
  mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
  ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
  lghrdvarylraaaggtrgsnharidaaegpsdipd