PDB entry 1dc1

View 1dc1 on RCSB PDB site
Description: restriction enzyme bsobi/DNA complex structure: encirclement of the DNA and histidine-catalyzed hydrolysis within a canonical restriction enzyme fold
Class: hydrolase/DNA
Keywords: protein-DNA complex, restriction endonuclease, thermophilic enzyme, degenerate DNA recognition, hydrolase/DNA complex
Deposited on 1999-11-04, released 2001-02-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bsobi restriction endonuclease
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70985 (Start-322)
      • conflict (204)
    Domains in SCOPe 2.06: d1dc1a_
  • Chain 'B':
    Compound: bsobi restriction endonuclease
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70985 (Start-322)
      • conflict (204)
    Domains in SCOPe 2.06: d1dc1b_
  • Chain 'C':
    Compound: DNA (5'-d(*t*ap*tp*ap*cp*tp*cp*gp*ap*gp*tp*ap*t)-3')
    Species: synthetic, synthetic
  • Chain 'W':
    Compound: DNA (5'-d(*t*ap*tp*ap*cp*tp*cp*gp*ap*gp*tp*ap*t)-3')
    Species: synthetic, synthetic
  • Heterogens: DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dc1A (A:)
    mntqkpfenhlksvddlkttyeeyragfiafaleknkrstpyieraralkvaasvaktpk
    dllylediqdallyasgisdkakkflteddkkesinnlienflepageefidelifryll
    fqgdslggtmrniagalaqqkltraiisaldianipykwldsrdkkytnwmdkpeddyel
    etfakgiswtingkhrtlmynitvslvkknvdiclfncepeiytpqkvhqqpekylllge
    lkggidpagadehwktantaltrirnkfsekglspktifigaaiehsmaeeiwdqlqsgs
    ltnsanltkteqvgslcrwiini
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dc1A (A:)
    kpfenhlksvddlkttyeeyragfiafaleknkrstpyieraralkvaasvaktpkdlly
    lediqdallyasgisdkakkflteddkkesinnlienflepageefidelifryllfqgd
    slggtmrniagalaqqkltraiisaldianipykwldsrdkkytnwmdkpeddyeletfa
    kgiswtingkhrtlmynitvslvkknvdiclfncepqqpekylllgelkggidpagadeh
    wktantaltrirnkfsekglspktifigaaiehsmaeeiwdqlqsgsltnsanltkteqv
    gslcrwiini
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dc1B (B:)
    mntqkpfenhlksvddlkttyeeyragfiafaleknkrstpyieraralkvaasvaktpk
    dllylediqdallyasgisdkakkflteddkkesinnlienflepageefidelifryll
    fqgdslggtmrniagalaqqkltraiisaldianipykwldsrdkkytnwmdkpeddyel
    etfakgiswtingkhrtlmynitvslvkknvdiclfncepeiytpqkvhqqpekylllge
    lkggidpagadehwktantaltrirnkfsekglspktifigaaiehsmaeeiwdqlqsgs
    ltnsanltkteqvgslcrwiini
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dc1B (B:)
    qkpfenhlksvddlkttyeeyragfiafaleknkrstpyieraralkvaasvaktpkdll
    ylediqdallyasgisdkakkflteddkkesinnlienflepageefidelifryllfqg
    dslggtmrniagalaqqkltraiisaldianipykwldsrdkkytnwmdkpeddyeletf
    akgiswtingkhrtlmynitvslvkknvdiclfncepqqpekylllgelkggidpagade
    hwktantaltrirnkfsekglspktifigaaiehsmaeeiwdqlqsgsltnsanltkteq
    vgslcrwiini
    

  • Chain 'C':
    No sequence available.

  • Chain 'W':
    No sequence available.