PDB entry 1dbz

View 1dbz on RCSB PDB site
Description: c153s mutant of pea fructose-1,6-bisphosphatase
Class: hydrolase
Keywords: chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, disulfide bridge, calvin cycle, hydrolase
Deposited on 1999-11-03, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.235
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dbza_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46275 (Start-356)
      • engineered (152)
    Domains in SCOPe 2.07: d1dbzb_
  • Chain 'C':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46275 (Start-356)
      • engineered (152)
    Domains in SCOPe 2.07: d1dbzc_
  • Chain 'D':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dbzd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbzA (A:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeslpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbzA (A:)
    iitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltedqkkldvisne
    vfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgiy
    spnntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftldplygefvl
    tqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrt
    llyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqpteihqrvp
    lyigsteevekvekyla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbzB (B:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeslpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbzB (B:)
    yeiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgedqkkldvi
    snevfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsif
    giyspndeslpdntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftl
    dplygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryig
    slvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiq
    pteihqrvplyigsteevekvekyla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dbzC (C:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeslpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbzC (C:)
    iitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgedqkkldvisn
    evfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgi
    yspndesldntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftldpl
    ygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigslv
    gdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqpte
    ihqrvplyigsteevekvekyla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dbzD (D:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeslpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbzD (D:)
    eiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltedqkkldvisn
    evfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgi
    yspndentlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftldplyge
    fvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigslvgdf
    hrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqpteihq
    rvplyigsteevekvekyla